Skip to content

Sermorelin

$69.00 $62.10
Research Use Only
Synthetic Peptide
COA Available
IN STOCK
SKU: SN

Description

Sermorelin 5 mg is a synthetic peptide research material corresponding to the 1-29 amino-acid amide fragment of human growth hormone-releasing hormone. Vertex Labs supplies Sermorelin as 5 mg of lyophilized research material within a single sealed vial for controlled laboratory evaluation and non-clinical research workflows.

Its defined amino-acid sequence, peptide length, and molecular characteristics provide clear identifiers for laboratory documentation, material tracking, and research environments where batch consistency, controlled handling, and accurate compound identification are required.

Product Specifications

Compound NameSermorelin
Alternative NamesGRF 1-29 NH₂ / Sermorelin Acetate / Geref
Compound ClassSynthetic Peptide Amide
Peptide Length29 Amino Acids
SequenceYADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂
Structural FeatureAmidated 1-29 Fragment of Human GHRH
CAS Number86168-78-7
Molecular FormulaC149H246N44O42S
Molecular WeightApprox. 3357.9 g/mol
Available Strength5 mg
Total Fill Amount5 mg per Vial
FormLyophilized Powder
Reconstitution StatusNot Reconstituted
Container TypeSealed Vial
DocumentationBatch-Level COA Available
Intended UseLaboratory Research Only
HandlingQualified Personnel Only
StorageStore According to Product Label

Research Material Identification

Sermorelin is identified by its defined 29-amino-acid sequence, YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂, associated molecular characteristics, and labeled 5 mg fill amount. These identifiers help distinguish the material from other GHRH-related peptide research compounds and support accurate documentation within controlled laboratory environments.

Researchers should verify the 5 mg strength, vial labeling, batch number, sequence information, and corresponding analytical documentation before use. Maintaining clear material identification and batch traceability supports consistency across laboratory workflows.

Quality & Documentation

Each Sermorelin 5 mg batch released by Vertex Labs is supported by batch-level documentation and Certificate of Analysis availability following quality review. Documentation may include identity confirmation, purity assessment, active weight verification, labeling review, and other analytical information relevant to the specific research batch.

Review available batch documentation through the
Vertex Labs COA database.
Additional information regarding laboratory review procedures, documentation standards, and quality controls is available on our
Testing Standards page.

Handling & Storage

Sermorelin 5 mg should be handled using established laboratory practices and appropriate internal quality procedures. Personnel should review the labeled strength, product labeling, batch-specific documentation, container condition, and applicable storage requirements before use in a controlled laboratory environment.

Keep the vial sealed until required for laboratory preparation and store the material according to the conditions specified on the product label. Laboratories should maintain appropriate handling, documentation, and material-control procedures for their research environment.

Research Use Only Notice

For Research Use Only. Not for human consumption. Not for veterinary use. Not intended for diagnosis, treatment, cure, or prevention of any disease.

10% Off + Free Shipping, your new-customer discount is active. Free Shipping SCOUTER copy code