Research compounds
Sermorelin
Synthetic Peptide Amide
In Stock
Dispatch from Vertex Labs
Same-day cutoff in
Cutoff: 3 PM ET Mon–Fri · Noon ET Sat · In-stock items
Customer experiences
Shipping, packaging & service.
Selected reviews of Vertex Labs as a store.
“Great time of delivery, came fast and safe in nice packaging very reliable would recommend”
“Discreet packaging. Well packaged. Delivered timely. I do like the price as I got a discount”
The compound
Description
Sermorelin 5 mg is a synthetic peptide research material corresponding to the 1-29 amino-acid amide fragment of human growth hormone-releasing hormone. Vertex Labs supplies Sermorelin as 5 mg of lyophilized research material within a single sealed vial for controlled laboratory evaluation and non-clinical research workflows.
Its defined amino-acid sequence, peptide length, and molecular characteristics provide clear identifiers for laboratory documentation, material tracking, and research environments where batch consistency, controlled handling, and accurate compound identification are required.
Technical profile
Product specifications
- Form
- Lyophilized Powder
- Documentation
- Batch-Level COA Available
- Compound Name
- Sermorelin
- Alternative Names
- GRF 1-29 NH₂ / Sermorelin Acetate / Geref
- Compound Class
- Synthetic Peptide Amide
All specifications
- Peptide Length
- 29 Amino Acids
- Sequence
- YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂
- Structural Feature
- Amidated 1-29 Fragment of Human GHRH
- CAS Number
- 86168-78-7
- Molecular Formula
- C149H246N44O42S
- Molecular Weight
- Approx. 3357.9 g/mol
- Available Strength
- 5 mg
- Total Fill Amount
- 5 mg per Vial
- Reconstitution Status
- Not Reconstituted
- Container Type
- Sealed Vial
- Intended Use
- Laboratory Research Only
- Handling
- Qualified Personnel Only
- Storage
- Store According to Product Label
Quality & Documentation
Browse the Research Peptides & Proteins catalog to compare individual materials and labeled vial amounts.
Each Sermorelin 5 mg batch released by Vertex Labs is supported by batch-level documentation and Certificate of Analysis availability following quality review. Documentation may include identity confirmation, purity assessment, active weight verification, labeling review, and other analytical information relevant to the specific research batch.
Review available batch documentation through the
Vertex Labs COA database.
Additional information regarding laboratory review procedures, documentation standards, and quality controls is available on our
Testing Standards page.
Handling & Storage
Sermorelin 5 mg should be handled using established laboratory practices and appropriate internal quality procedures. Personnel should review the labeled strength, product labeling, batch-specific documentation, container condition, and applicable storage requirements before use in a controlled laboratory environment.
Keep the vial sealed until required for laboratory preparation and store the material according to the conditions specified on the product label. Laboratories should maintain appropriate handling, documentation, and material-control procedures for their research environment.
Research Material Identification
Batch certificates for Sermorelin
Match the compound, presentation and lot on your vial with the original report. These records do not confirm which lot is currently shipping. A blend requires its own report; certificates for its individual components do not verify the blend.
Read the GHRH analog, Ipamorelin and blend comparison for an overview of the group. For the specific sequence and DAC distinctions, see Sermorelin vs CJC-1295. Sermorelin and Modified GRF (1-29) are distinct materials.
Sermorelin is identified by its defined 29-amino-acid sequence, YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂, associated molecular characteristics, and labeled 5 mg fill amount. These identifiers help distinguish the material from other GHRH-related peptide research compounds and support accurate documentation within controlled laboratory environments.
Researchers should verify the 5 mg strength, vial labeling, batch number, sequence information, and corresponding analytical documentation before use. Maintaining clear material identification and batch traceability supports consistency across laboratory workflows.
For Research Use Only. Not for human consumption. Not for veterinary use. Not intended for diagnosis, treatment, cure, or prevention of any disease.
Batch documentation
Know your batch.
The details behind the batch
Analytical results
Results transcribed from the assigned certificate. Refer to the original report for methods and full context.
- Tested material
- Sermorelin
- Purity
- 99.5%
- Measured content / potency
- 6.5 mg (131%)
- Identity
- Confirmed (FTIR)
- Report ID
- COA261724-005
- Appearance
- white powder
- Endotoxins
- Sterility
- Heavy metals
For research use only. A certificate describes the tested sample and is not a statement of suitability for human or veterinary use.
You may also like…
-
-
In StockTESA (Tesamorelin)
Synthetic Peptide5 mg10 mgSee Options This product has multiple variants. The options may be chosen on the product pagePrice range: $79.00 through $119.00Price range: $71.10 through $107.10 with SCOUTER -
-
In StockTESA + IPA — Tesamorelin + Ipamorelin Blend
Tesamorelin · Ipamorelin5 mg + 5 mgAdd to Cart$109.00$98.10 with SCOUTER -
SaleCJC-1295 No DAC
Synthetic Peptide10 mgOriginal price was: $79.00.$59.00Current price is: $59.00.Add to Cart -
In StockCJC-1295 No DAC + Ipamorelin Blend
CJC-1295 NO DAC · Ipamorelin5 mg + 5 mgAdd to Cart$99.00$89.10 with SCOUTER
Related products
Other sequences you may find relevant for your research.
-
-
Out of StockVIP
Synthetic Peptide5 mgOriginal price was: $89.00.$69.00Current price is: $69.00.View Product -
SaleBPC-157
Synthetic Peptide5 mg10 mgPrice range: $49.00 through $69.00See Options This product has multiple variants. The options may be chosen on the product page